Research use only. Not for human or veterinary use. Sold to qualified researchers only.Free cold-pack express over $200 · Synthesized in Los Angeles
LA Peptide LabsLos Angeles · CA
Compound profile

Semaglutide

Semaglutide is a synthetic, acylated analog of glucagon-like peptide-1 (GLP-1) that functions as a selective agonist at the GLP-1 receptor. It is used in in-vitro research as a reference ligand for receptor-binding, signaling, and characterization assays.

View product · from $95

What it is

Semaglutide is a 31-residue acylated peptide derived from the human GLP-1(7-37) backbone. Relative to native GLP-1 it carries two backbone substitutions—2-aminoisobutyric acid (Aib) in place of alanine at GLP-1 position 8, and arginine in place of lysine at position 34—together with a C18 fatty-diacid (octadecanedioic acid) side chain attached to the lysine at GLP-1 position 26 through a γGlu-2×OEG (mini-PEG) spacer. These modifications confer resistance to dipeptidyl peptidase-4 (DPP-4) cleavage and promote reversible albumin binding; both properties are studied in vitro to characterize peptide proteolytic stability and protein-interaction behavior. It is supplied as a lyophilized solid for laboratory use and is one of several GLP-1 receptor agonist peptide analogs (alongside molecules such as liraglutide) used as comparator ligands in receptor pharmacology.

Mechanism (in-vitro research context)

In receptor-pharmacology research, semaglutide acts as a high-affinity, selective agonist of the GLP-1 receptor (GLP-1R), a class B (secretin-family) G protein-coupled receptor. In cell-based in-vitro systems expressing recombinant GLP-1R, agonist binding couples to Gαs and stimulates adenylate cyclase, producing measurable increases in intracellular cyclic AMP (cAMP); downstream readouts include PKA activation and β-arrestin recruitment. These assays are used to determine binding affinity (Kd/Ki), potency (EC50), and signaling bias relative to native GLP-1 and other analogs. The Aib8 substitution is studied for its role in conferring resistance to DPP-4-mediated N-terminal proteolysis, while the fatty-diacid moiety is examined in the context of in-vitro serum-albumin binding kinetics.

Research areas

  • GLP-1 receptor (GLP-1R) binding-affinity and competition assays in recombinant cell lines
  • cAMP accumulation and Gαs-coupled signaling characterization
  • β-arrestin recruitment and receptor internalization studies
  • Comparative GLP-1 receptor agonist structure-activity relationship (SAR) profiling
  • In-vitro proteolytic stability assays (DPP-4 resistance) and serum-albumin binding kinetics
  • Analytical method development for peptide identity and purity (RP-HPLC / LC-MS)

Chemistry

Molecular weight
4113.58 g/mol
CAS
910463-68-2
Formula
C187H291N45O59
Sequence
H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG (GLP-1(7-37) backbone with Aib at GLP-1 position 8 and Arg at position 34; Lys at GLP-1 position 26 acylated with an octadecanedioic acid (C18 fatty-diacid) chain via a γGlu-2×OEG linker)

Laboratory handling

Typically supplied as a lyophilized powder. For long-term laboratory storage the lyophilate is generally held desiccated at -20 C, protected from light and moisture. Reconstituted stock solutions are commonly aliquoted to minimize freeze-thaw cycles and stored frozen; working solutions are kept cold and used promptly to limit aggregation and hydrolytic or oxidative degradation. As an acylated peptide, semaglutide may show surface adsorption and concentration-dependent self-association, so analytical handling (e.g., low-bind labware, appropriate buffer selection) is considered during assay design. Identity and stability are monitored over time by RP-HPLC and mass spectrometry. This stability framing pertains to analytical/laboratory handling only.

FAQ

What is the amino acid sequence of semaglutide?

Semaglutide is built on the human GLP-1(7-37) backbone (H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG), incorporating 2-aminoisobutyric acid (Aib) in place of alanine at GLP-1 position 8 and arginine in place of lysine at position 34. The lysine at GLP-1 position 26 is acylated with a C18 fatty-diacid chain attached through a γGlu-2×OEG linker.

What are the molecular weight and molecular formula?

The reported average molecular weight is approximately 4113.58 g/mol, and the molecular formula is C187H291N45O59. Its CAS Registry Number is 910463-68-2.

How is the identity and purity of the peptide verified?

Identity is typically confirmed by mass spectrometry (ESI-MS or MALDI-TOF) against the theoretical monoisotopic/average mass, and purity is assessed by reversed-phase HPLC (commonly reported as area-percent at a defined wavelength). Amino acid analysis and sequencing can provide additional confirmation.

What receptor does semaglutide target in in-vitro assays?

It is a selective agonist of the GLP-1 receptor (GLP-1R), a class B G protein-coupled receptor. In recombinant cell systems, agonism is read out through Gαs-coupled cAMP accumulation and related signaling endpoints.

How should it be stored in the laboratory?

The lyophilized peptide is generally stored desiccated at -20 C, protected from light and moisture. Reconstituted solutions are usually aliquoted, kept frozen for longer-term storage, and freeze-thaw cycles minimized to preserve analytical stability.

References

Research-use only

For laboratory research use only. Not for human or veterinary use. Not for diagnostic or therapeutic use. These products have not been approved or evaluated by the U.S. Food and Drug Administration. No statement on this site has been evaluated by the FDA. These products are not intended to diagnose, treat, cure, mitigate, or prevent any disease, and are not intended for human or veterinary use. See our research-use terms and terms of service.